IndexProfielRegistrerenHelpActive TopicsSearch Inloggen
Index / Muziek algemeen Nieuw Topic Post Reply
Dit topic is 8 pagina's lang: 1 2 3 4 5 6 7 8
Auteur:
Topic : ZM Jaarlijst | 2018 Volgende pagina
iPim
rijdt Negatieveling approved
Usericon van iPim
Posted 16-12-2018 19:50 by iPim (Administrator) Wijzig reactieProfiel van iPimQuote dit bericht



Zware Metalen maakt zich alweer klaar voor de vijftiende editie van de ZM Jaarlijst! De veelkoppige redactie werkt zich iedere dag in het zweet om de trouwe lezers te wijzen op de beste metalmuziek, maar dit is dé uitgelezen kans om dat eenrichtingsverkeer om te draaien. Welke albums zijn de lezers van Zware Metalen het sterkste bijgebleven? Laat jouw jaarlijstje in dit topic achter. De inzendingen zullen we op één grote hoop gooien om de beste 50 albums van 2018 te bepalen.

(Er zal in dit topic ook een jaarlijst gepubliceerd worden louter op basis van in dit topic achtergelaten inzendingen.)



Welke plaat wordt de opvolger van:

- Behemoth – Demigod (2004)
- Opeth – Ghost Reveries (2005)
- Satyricon – Now, Diabolical (2006)
- Primordial – To the Nameless Dead (2007)
- Enslaved – Vertebrae (2008)
- Sólstafir – Köld (2009)
- Enslaved – Axioma Ethica Odini (2010)
- Primordial – Redemption at the Puritan’s Hand (2011)
- Marduk – Serpent Sermon (2012)
- Carcass – Surgical Steel (2013)
- Yob – Clearing the Path to Ascend (2014)
- My Dying Bride – Feel the Misery (2015)
- Oranssi Pazuzu – Värähtelijä (2016)
- Amenra – Mass VI (2017)


Bekijk hier de jaarlijsten van alle voorgaande jaren:

2017
2016
2015
2014
2013
2012
2011
2010
2009
2008
2007
2006
2005
2004

De gebruikelijke regels gelden weer:

- Graag niet (teveel) slowchatten tussen de lijstjes door, zodat ik een beetje overzicht kan houden.
- Het album moet in 2018 uitgekomen zijn;
- Uiteraard is het maar toegestaan om één lijst te plaatsen. Dit zal nauwkeurig in de gaten worden gehouden;
- Om mee te mogen stemmen, dien je geregistreerd te zijn bij ZM vóór vandaag 16-12-2018.
- Graag je lijst uiterlijk 4 januari 2019 insturen! De uitslag zal daarna spoedig op de frontpage geplaatst worden;
- Graag volledige titels;
- MAXIMAAL EEN TOP 20 IS TOEGESTAAN! MINIMAAL 10. Lijstjes korter dan 10 worden geschrapt;
- Geen re-releases, geen boxsets, geen DVD's, geen verzamelaars, geen splits, geen live-albums en geen mini's/singles/demo's/EP's. Hier doen we bij echte twijfelgevallen natuurlijk niet moeilijk, maar we proberen hier een albumjaarlijst samen te stellen.
- Mocht je je in dit topic geplaatste lijst willen wijzigen, quote dan alsjeblieft je lijst en plaats je nieuwe lijst als reactie op je eigen quote. Dit zodat ik niet steeds hoef terug te zoeken. LIEFST WEL ZO WEINIG MOGELIJK WIJZIGINGEN, DUS PROBEER JE DEFINITIEVE LIJST TE PLAATSEN!
- Mailen van je jaarlijst mag ook: jaarlijst@zwaremetalen.com (onderwerp 'ZM Jaarlijst')

Succes en bedankt voor de moeite alvast en voor het in acht nemen van bovenstaande punten!

[Dit bericht is gewijzigd door iPim op 29-12-2018 1:08]


Vladimir: That passed the time. Estragon: It would have passed in any case.


iPim
rijdt Negatieveling approved
Usericon van iPim
Posted 16-12-2018 20:21 by iPim (Administrator) Wijzig reactieProfiel van iPimQuote dit bericht

1. Vein - Errorzone
2. Carpenter Brut - Leather Teeth
3. Fucked Up - Dose Your Dreams
4. Death Grips - Year Of The Snitch
5. Birds In Row - We Already Lost The World
6. KEN Mode - Loved
7. Drug Church - Cheer
8. Ondt Blod - Natur
9. Tomb Mold - Manor Of Infinite Forms
10. Slaves - Acts Of Fear And Love
11. Thrice - Palms
12. Basement - Beside Myself
13. Bongripper - Terminal
14. Primal Rite - Dirge Of Escapism
15. Sleep - The Sciences
16. Mantar - The Modern Art Of Setting Ablaze
17. Candy - Good To Feel
18. Homewrecker - Hell Is Here Now
19. Night Verses - From The Gallery Of Sleep
20. Harms Way - Posthuman


Vladimir: That passed the time. Estragon: It would have passed in any case.


Wytze
Usericon van Wytze
Posted 16-12-2018 20:37 by Wytze Wijzig reactieProfiel van WytzeQuote dit bericht

01. The Body - I have fought against it but I can't any longer
02. Servants of the Apocalyptic Goat Rave - Queen of Darkness
03. Ultha - The Inextricable Wandering
04. Wiegedood - De doden heb het goed III
05. Anaal Nathrakh - A new Kind of Horror
06. Virgin Black - Requiem Pianissimo
07. Cloak of Altering - Zero Devil
08. Abstracter - Cinereaous Incarnate
09. Orphaned Land - Unsung Prophets and Dead Messiahs
10. Einar Selvik & Ivar Bjornson - Hugsja
11. Primordial - Exile amongst the Ruins
12. Deafheaven - Ordinary Corrupt Human Love
13. Gnaw Their Tongues - Genocidal Majesty
14. Alien Weaponry - Tu
15. Sleep - The Sciences
16. Ihsahn - Amr
17. Yob - Our Raw Heart
18. Suffering Quota - Life in Disgust
19. Immortal - Northern Chaos Gods
20. Azaghal - Valo Pohjoisesta


mikkasscar
Usericon van mikkasscar
Posted 17-12-2018 0:43 by mikkasscar Wijzig reactieProfiel van mikkasscarQuote dit bericht

Abstracter – Cinerous Incarnate
Pa Vesh En - Church of Bones
Death Scepter – Black Trance
Low - Double Negative
Nothing – Dance on the Blacktop

Occelensbrigg - The Cosmic Winter State
Black Howling - Return of Primordial Stillness
Craft – White Noise and Black Metal
Soft Kill – Savior
Bosse-de-Nage – Further still

Wiegedood – De Doden Hebben het Goed III
Beach House – 7
Drudkh – They Often See Dreams About the Spring
Angantyr - Ulykke
Manes – Slow Motion Death Sequence

Cosmic Church – Tayttymys
King Dude – Music to make war to
Iceage – Beyondless
Interpol - Marauder
Behemoth – I loved you at your darkest


Mark Z
Doomsower
Usericon van Mark Z
Posted 17-12-2018 7:54 by Mark Z Wijzig reactieProfiel van Mark ZQuote dit bericht

01) Dautha - Brethren of the Black Soil
02) Burial Invocation - Abiogenesis
03) Solstice - White Horse Hill
04) Mare - Ebony Tower
05) Witchsorrow - Hexenhammer
06) Varathron — Patriarchs of Evil
07) Taphos - Come Ethereal Somberness
08) Ataraxy - Where All Hope Fades
09) Apostle of Solitude - From Gold to Ash
10) Mournful Congregation - The Incubus of Karma
11) Obliteration - Cenotaph Obscure
12) Seven Sisters - The Cauldron and the Cross
13) Pale Divine - s/t
14) Horrendous - Idol
15) Messa - Feast for Water
16) Wytch Hazel - II: Sojourn
17) Iron Void - Excalibur
18) Ghastly - Death Velour
19) Tribulation - Down Below
20) Evoken - Hypnagogia


LastFM | Untappd | Twitter | Doom what thou wilt shall be the whole of the law


Varian
Black and White Viking
Usericon van Varian
Posted 17-12-2018 9:24 by Varian Wijzig reactieProfiel van VarianQuote dit bericht

01. Helrunar - Vanitas Vanitatvm
02. Thou - Magus
03. Pijn - Loss
04. Uada - Cult of a Dying Sun
05. Doomed - 6 Anti-Odes To Life
06. Lowen - A Crypt in the Stars
07. Verheerer - Maltrér
08. Sleep - The Sciences
09. Gaerea - Unsettling Whispers
10. Evoken - Hypnagogia
11. Drudkh - They Often See Dreams About the Spring
12. Immortal - Northern Chaos Gods
13. Wiegedood - De Doden Hebben Het Goed III
14. Ultha - The Inextricable Wandering
15. Ancestors - Suspended in Reflections
16. Décembre Noir - Autumn Kings
17. Throneless - Cycles
18. Spurv - Myra
19. Messa - Feast for Water
20. Besra - Anhedonia


Weep not for me.....it`s all the better lost


OZZWorks
Pussy Music
Usericon van OZZWorks
Posted 17-12-2018 10:08 by OZZWorks (Hoofdredacteur) Wijzig reactieProfiel van OZZWorksQuote dit berichthttp://www.zwaremetalen.com/

1. The Night Flight Orchestra - Sometimes the World Ain't Enough
2. Carpenter Brut - Leather Teeth
3. Ace Frehley - Spaceman
4. Judas Priest - Firepower
5. Overruled - Hybris
6. Against Evil - All Hail the King
7. Christian Tolle Project - Point Blank
8. Gama Bomb - Speed Between the Lines
9. Alien Weaponry - Tū
10. Audrey Horne - Blackout
11. Hatesphere - Reduced to Flesh
12. Hatchet - Dying to Exist
13. Metal Church - Damned If You
14. Michael Romeo - War of the Worlds // Pt. 1
15. Objector - Social Intolerance


Hier had uw advertentie kunnen staan!


bastianus
Usericon van bastianus
Posted 17-12-2018 11:16 by bastianus Wijzig reactieProfiel van bastianusQuote dit bericht

Kleine aanpassing. Kan dat nog?

1. Ghost - Prequelle
2. High on fire - Electric Messiah
3. Clutch - Book of bad decisions
4. Aura Noir - Aura Noire
5. Necrophobic - Mark of the necrogram
6. First aid kit - Ruins
7. Joe Bonamassa - Redemption
8. Nile Rodgers & Chic - It’s about time
9. Imagine dragons - Origins
10. A perfect circle - Eat the elephant



[Dit bericht is gewijzigd door bastianus op 30-12-2018 19:40]


Het radicale feminisme is niet eens een lachnummer meer: het is een karikatuur van een parodie op een klucht.


Fusion
The Dude? Meer De Forum Clown
Usericon van Fusion
Posted 17-12-2018 11:27 by Fusion Wijzig reactieProfiel van FusionQuote dit berichthttp://mystic.bandcamp.com/

#magikmijnextreemlolligejaarlijstmetfictievemetalclichesweerpostenoflieverniet?


When your people matter, menstrual health matters


Buiksmurf
Usericon van Buiksmurf
Posted 17-12-2018 12:04 by Buiksmurf Wijzig reactieProfiel van BuiksmurfQuote dit bericht

1. Chapel Of Disease - ...And As We Have Seen The Storm, We Have Embraced The Eye
2. Pale Divine - Pale Divine
3. Horrendous - Idol
4. Funeral Mist - Hekatomb
5. Varathron - Patriarchs Of Evil
6. Burial Invocation - Abiogenesis
7. Solstice - White Horse Hill
8. Tribulation - Down Below
9. Corpsessed - Impetus Of Death
10. Primordial - Exile Among The Ruins
11. Satan - Cruel Magic
12. Chaos Echoes - Mouvement
13. Vanhelgd - Deimos Sanktuarium
14. Convocation - Scars Across
15. Faal - Desolate Grief
16. Obliteration – Cenotaph Obscure
17. Mournful Congregation - The Incubus Of Karma
18. Ataraxy – Where All Hope Fades
19. Hooded Menace – Ossuarium Silhouettes Unhallowed
20. Atavisma – The Chthonic Rituals


DecomposingBitch
Schwa
Usericon van DecomposingBitch
Posted 17-12-2018 13:01 by DecomposingBitch Wijzig reactieProfiel van DecomposingBitchQuote dit bericht

Jeetje, wat is er veel uitgekomen dit jaar. Moeilijk om een definitieve keuze te maken, maar bij deze een poging. Of het helemaal in de perfecte volgorde is, daar kom ik denk ik nooit helemaal uit, maar de lijst moet toch in een volgorde staan... :-)

Jaarlijst 2018

1. Cataya - Firn
2. Hugsjá - Hugsjá
3. Warrel Dane – Shadow Work
4. Carpenter Brut – Leather Teeth
5. In Vain - Currents
6. Shining - Animal
7. Primordial - Exile Amongst the Ruins
8. Wiegedood - De Doden Hebben het Goed III
9. Amorphis – Queen of TIme
10. At The Gates – To Drink from the Night itself
11. Tribulation - Down Below
12. Zeal & Arbor - Stranger Fruit
13. Shylmagoghnar – Transcience
14. The Ocean – Phanerozoic I: Palaezoic
15. Behemoth – I loved you at your Darkest
16. Uada - Cult of a Dying Sun
17. Harakiri for the Shy – Arson
18. Slægt – The Wheel
19. Summoning - With Doom We Come
20. Myles Kennedy - Year of the Tiger


"Victimize me, vilify me. Vilipend and amend the sins you condign. You are nothing and you speak for all that never was."


Volke
Usericon van Volke
Posted 17-12-2018 14:11 by Volke Wijzig reactieProfiel van VolkeQuote dit berichthttp://https://rateyourmusic.com/~Knocklekopf

1) Urfaust - The constellatory Practice
2) Spectral Wound - Infernal Decadence
3) Sleep - The Sciencess
4) Panopticon - The Scars of Man on the Once Nameless Wilderness
5) Kriegsmaschine - Apocalypticists
6) Ultha - The Inextricable Wandering
7) Daughters - You Won't Get What You Want
8) Unreqvited - Stars Wept to the Sea
9) One Tail, One Head - Worlds Open, Worlds Collide
10) Rûr - RÛR
11) Imperial Triumphant - Vile Luxury
12) Bloodbath - The Arrow of Satan is Drawn
13) Shining - Varg Utan Flock
14) Skeletonwitch - Devouring Radiant Light
15) Sargeist - Unbound
16) Watain - Trident Wolf Eclipse
17) Vermilia - Kätkyt
18) Gamma Bomb - Speed Between the Lines
19) Portal - Ion
20) Harakiri for the Sky - Arson

[Dit bericht is gewijzigd door Volke op 17-12-2018 14:12]


"To learn who rules over you, simply find out who you are not allowed to criticise"


Bannink
Usericon van Bannink
Posted 17-12-2018 15:08 by Bannink Wijzig reactieProfiel van BanninkQuote dit bericht

1. Zeal & Ardor - Stanger Fruit
2. Behemoth - I Love You At Your Darkest
3. Deafheaven - Ordinary Corrupt Human Love
4. Ultha - The Inextricable Wandering
5. Wiegedood - De Doden Hebben Het Goed III
6. Ancestors - Suspended In Reflections
7. In The Woods.. - Cease The Day
8. Anal Nathrakh - A New Kind Of Horror
9. MØL - Jord
10. Horrendous - Idol
11. Conan - Existential Void Guardians
12. High On Fire - Electric Messiah
13. Rivers Of Nihil - Where Owls Know My Name
14. Shinning - X Varg Utan Flock
15. Revocation - The Other Ones
16. Khorada - salt
17. Ancst - Ghosts Of The Timeless Void
18. Joe Bonamassa - Redemption
19. Boss Keloid - Melted On The Inch
20. Long Distance Calling - Boundless

[Dit bericht is gewijzigd door Bannink op 22-12-2018 7:50]


Buiksmurf
Usericon van Buiksmurf
Posted 17-12-2018 15:12 by Buiksmurf Wijzig reactieProfiel van BuiksmurfQuote dit bericht

quote:
Op 17 december 2018 15:08 schreef Bannink het volgende:

19. Dodechadron - Live in Leiden



- Geen re-releases, geen boxsets, geen DVD's, geen verzamelaars, geen splits, geen live-albums en geen mini's/singles/demo's/EP's. Hier doen we bij echte twijfelgevallen natuurlijk niet moeilijk, maar we proberen hier een albumjaarlijst samen te stellen.


zodiac lung
Usericon van zodiac lung
Posted 17-12-2018 18:27 by zodiac lung Wijzig reactieProfiel van zodiac lungQuote dit berichthttp://https://www.last.fm/user/Panzerke

01. Current 93 - The Light Is Leaving Us All
02. Panopticon - The Scars of Man on the Once Nameless Wilderness
03. Crippled Black Phoenix - Great Escape
04. Ivar Bjørnson & Einar Selvik- Hugsja
05. Sleep - The Sciences
06. Trembling Bells - Dungeness
07. Sangre de Muerdago - Noite
08. Anna von Hausswolff - Dead Magic
09. Spiritual Front - Amour Braque
10. Zu93 - Mirror Emperor

11. Bobby Beausoleil - Voodoo Shivaya
12. Dead Meadow - The Nothing They Need
13. Low - Double Negative
14. Årabrot - Who Do You Love
15. Wolvennest - VOID
16. King Dude - Music to Make War to
17. Winterfylleth - The Hallowing of Heirdom
18. Tribulation - Down Below
19. Monster Magnet - Mindfucker
20. Tusmørke - Fjernsyn I Farver

[Dit bericht is gewijzigd door zodiac lung op 17-12-2018 18:29]


One chord is fine. Two chords is pushing it. Three chords and you're into jazz.


Svartekunst
Usericon van Svartekunst
Posted 17-12-2018 20:07 by Svartekunst Wijzig reactieProfiel van SvartekunstQuote dit bericht

1. Ghost - Prequelle
2. Amorphis - Queen of Time
3. Behemoth - I Loved You at Your Darkest
4. Heidevolk - Vuur van Verzet
5. At the Gates - To Drink From the Night Itself
6. Skeletonwitch - Devouring Radiant Light
7. Ivar Bjørnson & Einar Selvik - Hugsjá
8. Judas Priest - Firepower
9. YOB - Our Raw Heart
10. Anaal Nathrakh - A New Kind of Horror

[Dit bericht is gewijzigd door Svartekunst op 17-12-2018 20:07]


Aikara
Usericon van Aikara
Posted 17-12-2018 20:46 by Aikara Wijzig reactieProfiel van AikaraQuote dit bericht

Een enigszins aangepaste lijst, want mijn nummber 1 van dit jaar is een live-album: Live Over Europe van Fates Warning. Geweldig live album, voor mij op het zeldzame niveau van albums als Strangers In The Night (UFO) en On Stage (Rainbow). Maar hierbij de lijst binnen de kaders voor de ZM jaarlijst:

1. Amorphis - Queen Of Time
2. Mile Marker Zero - The Fifth Row
3. Haken - Vector
4. Kingcrow - The Persistence
5. In Vain - Currents
6. Dynazty - Firesign
7. Michael Romeo - War Of The Worlds Part 1
8. Riverside - Wasteland
9. Tomorrow's Eve - Mirror Of Creation III, Project Ikaros
10. Seventh Wonder - Tiara
11. Mayan - Dhyana
12. The Pineapple Thief - Dissolution
13. Oceans Of Slumber - The Banished Heart
14. Uriah Heep - Living The Dream
15. Damian Wilson & Adam Wakeman - The Sun Will Dance In Its Twilight Hour
16. Monuments - Phronesis
17. The Night Flight Orchestra - Sometimes The World Ain't Enough
18. Kamelot - The Shadow Theory
19. Judas Priest - Firepower
20. The Sea Within - The Sea Within


Metal-D
Usericon van Metal-D
Posted 17-12-2018 22:25 by Metal-D (Speciaal lid) Wijzig reactieProfiel van Metal-DQuote dit bericht


1. Riverside - Wasteland
2. Arena - Double Vision
3. Southern Empire - Civilisation
4. Ghost - Prequelle
5. Voivod - The Wake
6. Immortal - Northern Chaos Gods
7. The Sea Within - The Sea Within
8. A Perfect Circle - Eat the Elephant
9. Judas Priest - Firepower
10. Oceans of Slumber - Banished Heart


Northward
Usericon van Northward
Posted 18-12-2018 2:29 by Northward Wijzig reactieProfiel van NorthwardQuote dit bericht

01. Carpenter Brut - Leather Teeth
02. Paul Kalkbrenner - Parts of Life
03. Ancestors - Suspended in Reflections
04. Lycia - In Flickers
05. Sleep - The Sciences
06. Masta Ace & Marco Polo - A Breukelen Story
07. Crippled Black Phoenix - Great Escape
08. Cloud Nothings - Last Burning Building
09. Uncle Acid & the Deadbeats - Wasteland
10. Turnstile - Time & Space
11. Urfaust - The Constellatory Practice
12. Deafheaven - Ordinary Corrupt Human Love
13. Summoning - With Doom We Come
14. Solar Temple - Fertile Descent
15. Ghost - Prequelle

[Dit bericht is gewijzigd door Northward op 18-12-2018 2:40]


Hypnos
Godmadeself
Usericon van Hypnos
Posted 18-12-2018 15:40 by Hypnos (Hoofdredacteur) Wijzig reactieProfiel van HypnosQuote dit bericht

1. Ævangelist - Matricide in the Temple of Omega
2. Arkhtinn - 最初の災害
3. Servants Of The Apocalyptic Goat Rave - Queen Of Darkness
4. Reverorum ib Malacht - Im Ra Distare Summum Soveris Seris Vas innoble
5. Mahr - Antelux
6. Master Boot Record - Virus.DOS
7. Borgne - [∞]
8. Hardcore Anal Hydrogen - HyperCut
9. Stilla - Synviljor
10. The Body – I Have Fought Against It, But I Can’t Any Longer
11. Pryapisme - Epic Loon OST
12. Clouds - Dor
13. Ov Shadows - The Darkness Between Stars
14. Amaranthe - Helix
15. Himelvaruwe - Hemelpoort
16. Convocation - Scars Across
17. Unreqvited - Stars Wept to the Sea
18. Knokkelklang - Jeg Begraver
19. Entropia - Vacuum
20. Solar Temple - Fertile Descent


signature


declaes
Usericon van declaes
Posted 18-12-2018 19:15 by declaes Wijzig reactieProfiel van declaesQuote dit bericht

1. Amorphis-Queen of Time
2. Kamelot- The Shadow Theory
3. Judas Priest- Firepower
4. Behemoth- I Love You at your Darkest
5. Primal Fear-Apocalypse
6. Kataklysm-Meditations
7. Lizzy Borden - My Midnight Things
8. Powerwolf - The Sacrament Of Sin
9. Manticora - To Kill To Live To Kill
10. Dynazty - Firesign


MisterIT
Usericon van MisterIT
Posted 18-12-2018 22:11 by MisterIT Wijzig reactieProfiel van MisterITQuote dit bericht

Het was nog even puzzelen welke nou de beste van afgelopen jaar was maar ik ben eruit:

1: Borgne - [∞]
2: A Forest Of Stars - Grave Mounds And Grave Mistakes
3: Wiegedood - De Doden Hebben Het Goed III
4: Urfaust - The Constellatory Practice
5: Mournful Congregation - The Incubus of Karma
6: Summoning - With Doom We Come
7: Anaal Nathrakh - A New Kind Of Horror
8: Immortal - Northern Chaos Gods
9: Aborted - TerrorVision
10: Wolfheart - Constellation Of The Black Light
11: Atra Vetosus - Apricity
12: Angantyr – Ulykke
13: Ingested - The Level Above Human
14: Fukpig - Bastards
15: Ancst - Ghosts Of The Timeless Void
16: Down Among The Dead Men - ….And You Will Obey Me
17: Kraanium - Slamchosis
18: Marduk - Viktoria
19: Barren Earth - A Complex Of Cages
20: Shining - X - Varg Utan Flock

[Dit bericht is gewijzigd door MisterIT op 18-12-2018 22:12]


BenKnuckles
Bencore
Usericon van BenKnuckles
Posted 19-12-2018 7:35 by BenKnuckles (Speciaal lid) Wijzig reactieProfiel van BenKnucklesQuote dit bericht

1. Sleep - The Sciences
2. Turnstile - Time & Space
3. Candy - Good to Feel
4. Damu the Fudgemunk & Flex Mathews - Dreams & Vibrations
5. Bombino - Deran
6. Ecostrike - Voice of Strength
7. Horrendous - Idol
8. Trail of Lies - W.A.R.
9. Death Grips - Year of the Snitch
10. Krimewatch - Krimewatch

11. Primal Rite - Dirge of Escapism
12. Aborted - TerrorVision
13. Merzbow - Monoakuma
14. Skyglow - Thousand Years of Terror
15. Vein - errorzone
16. Westside Gunn - Supreme Blientele
17. Judas Priest - Firepower
18. Spiritual Front - Amour Braque
19. Jesus Piece - Only Self
20. Andre Nickatina - Pisces


I'm lifted troop, you can bring your wack-ass crew


Cees_Masterkiller
Usericon van Cees_Masterkiller
Posted 19-12-2018 16:07 by Cees_Masterkiller (Speciaal lid) Wijzig reactieProfiel van Cees_MasterkillerQuote dit bericht

1. Deafheaven - Ordinary Corrupt Human Love
2. Shame - Songs of Praise
3. Behemoth - I Loved You At Your Darkest
4. Ghost - Prequelle
5. Greta van Fleet - Anthem Of The Peaceful Army
6. Sleep - The Sciences
7. Immortal - Northern Chaos Gods
8. IDLES - Joy As An Act Of Resistance
9. Conan - Existential Void Guardian
10. Watain - Trident Wolf Eclipse
11. Yob - Our Raw Heart
12. Earthless - Black Heaven
13. DeWolff - Thrust
14. The Sore Losers - Gracias Señor
15. Jeugd van Tegenwoordig - Leuk


[Dit bericht is gewijzigd door Cees_Masterkiller op 19-12-2018 16:11]


A metalheart is hard to tear apart


Nannemattie
Usericon van Nannemattie
Posted 20-12-2018 14:12 by Nannemattie Wijzig reactieProfiel van NannemattieQuote dit bericht

1) Winterfylleth: the Hallowing of heirdom
2) Mol: Jord
3) God is an Astronaut: Epitaph
4) Spurv: Myra
5) Primordial: Exile amongst the Ruins
6) Unreqvited: Stars wept to the Sea
7) Immortal : Northern Chaos Gods
8) Heidevolk: Vuur van Verzet
9) Mournful Congregation: the Incubus of Karma
10) Drudkh: They often see Dreams About the Spring
11) Wiegedood: de Doden hebben het Goed III
11) Monotheïst: Scourge
12) Revocation: The Outer Ones
13) Summoning: With Doom we Come
14) Amorphis: Queen of Time
15) Deathwhite: for a Black Tomorrow


Mutilator
SPILL YER GUTS !!!!!! (Extra gore mod)
Usericon van Mutilator
Posted 20-12-2018 18:05 by Mutilator (Moderator) Wijzig reactieProfiel van MutilatorQuote dit berichthttp://wp.livereviewer.com/

Dit zijn tot nu toe de originelen in huis:

01. Cosmic Atrophy - The Void Engineers
02. Slugdge - Esoteric Malacology
03. Ectoplasma - Cavern of foul unbeings
04. Augury - Illusive Golden Age
05. Voivod – The Wake
06. Of Feather and Bone - Bestial Hymns of Perversion
07. Ghost – Prequelle
08. Pestilence - Hadeon
09. Alkaloid - Liquid Anatomy
10. Aborted - Retrogore

11. Monstrosity - The Passage of Existence
12. Mammoth Grinder - Cosmic Crypt
13. Skeletal Remains - Devouring Mortality
14. Judas Priest- Firepower
15. Necrophobic - Mark of the Necrogram
16. Rivers of Nihil - Where Owls Know My Name
17. Dimmu Borgir – Eonian
18. Kalmah - Palo
19. Terrorizer - Caustic attack
20. Ritual Necromancy - Disinterred Horror

21. Night in Gales - The Last Sunsets
22. Burial Invocation - Abiogenesis
23. Hooded Menace - Ossuarium Silhouettes Unhallowed
24. Skinless – Savagery
25. Visigoth - Conqueror’s Oath

En dit de runners up:

26. Beyond Creation - Algorythm
27. The Beast of Nod – Vampira: disciple of chaos
28. Outre tombe - Necrovortex
29. Slaughterday - Abattoir EP
30. Gorod - Aethra
31. Blame - Almanac
32. Horizon Ablaze - The Weight of a Thousand Suns
33. Bloodshot Dawn - Reanimation
34. Varathron - Patriarchs of Evil
35. Baest - Danse macabre
36. Cancer - Shadow gripped
37. Krisiun - Scourge of the enthroned
38. Immortal - Northern Chaos Gods
39. Obscura - Diluvium
40. Skeletonwitch - Devouring Radiant Light
41. Sigh – Heir to despair
42. Portal - Ion
43. Sacral Rage – Beyond celestial echoes
44. Arsis - Visitant
45. Soulfly - Ritual
46. Cist - The Frozen Casket
47. Deicide - Overtures of blasphemy
48. Amorphis - Queen of time
49. Sadist – Spellbound
50. Created to kill - Summoned to rise
51. Hyperdontia - Nexus of teeth
52. Soreption - Monument of the End
53. Serocs - The Phobos / Deimos Suite

En dit gaat nog een luisterrondje krijgen:

Firtan - Okeanos
Psycroptic - As the Kingdom Drowns
Lecherous Nocturne - Occultaclysmic
Redemption - Long Night's Journey into Day
Dead End - The mind's asylum
Enfold Darkness - Adversary Omnipotent
Virulent Depravity - Fruit Of The Poisioned Tree
Anomalie - Integra
Siege of Power - Warning Blast
Decaying - To Cross the Line
Crippled Black Phoenix - Great Escape
Jungle Rot - Jungle Rot
The Crown - Cobra Speed Venom
Veld - S.I.N.
Sun Speaker - Ov Lustra
Dallian - Automata
Mechina - The Compendium
Temple- Design in Creation
Bloodbath - The Arrow of Satan Is Drawn
Behemoth - I Loved You at Your Darkest
Inferi - Revenant
Alpha Ascension - Adventures in J-Town
Alterbeast - Feast (tech)
Convulsing - Grievous
Oubliette - The passage
Revocation - The outer ones
Sulphur Aeon - The scythe of cosmic chaos
Irreversible Mechanism - Immersion
Aethereus - Absentia

[Dit bericht is gewijzigd door Mutilator op 20-12-2018 18:16]


The quality of our perceptions determines the quality of our judgement. Our judgement determines how we interact with the world. How we interact with the world changes the world. So, the quality of our perceptions changes the world.


Dit topic is 8 pagina's lang: 1 2 3 4 5 6 7 8
Index / Muziek algemeen Active topics Nieuw topic Post reply Volgende pagina
http://www.zwaremetalen.com
Powered by ZwareMetalen [PHP] Forum Versie 2.15.0
Optimized for Internet Explorer 6.0 SP2+ / Opera 8+ / Firefox 1+
© 2001 - 2024 Stichting ZwareMetalen