![]() |
![]() |
|||||
![]() |
![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
|||
|
![]() |
Dit topic is 8 pagina's lang: 1 2 3 4 5 6 7 8 | ||||
Auteur: |
|
|
![]() Zware Metalen maakt zich alweer klaar voor de vijftiende editie van de ZM Jaarlijst! De veelkoppige redactie werkt zich iedere dag in het zweet om de trouwe lezers te wijzen op de beste metalmuziek, maar dit is dé uitgelezen kans om dat eenrichtingsverkeer om te draaien. Welke albums zijn de lezers van Zware Metalen het sterkste bijgebleven? Laat jouw jaarlijstje in dit topic achter. De inzendingen zullen we op één grote hoop gooien om de beste 50 albums van 2018 te bepalen. (Er zal in dit topic ook een jaarlijst gepubliceerd worden louter op basis van in dit topic achtergelaten inzendingen.) ![]() Welke plaat wordt de opvolger van: - Behemoth – Demigod (2004) - Opeth – Ghost Reveries (2005) - Satyricon – Now, Diabolical (2006) - Primordial – To the Nameless Dead (2007) - Enslaved – Vertebrae (2008) - Sólstafir – Köld (2009) - Enslaved – Axioma Ethica Odini (2010) - Primordial – Redemption at the Puritan’s Hand (2011) - Marduk – Serpent Sermon (2012) - Carcass – Surgical Steel (2013) - Yob – Clearing the Path to Ascend (2014) - My Dying Bride – Feel the Misery (2015) - Oranssi Pazuzu – Värähtelijä (2016) - Amenra – Mass VI (2017) Bekijk hier de jaarlijsten van alle voorgaande jaren: 2017 2016 2015 2014 2013 2012 2011 2010 2009 2008 2007 2006 2005 2004 De gebruikelijke regels gelden weer: - Graag niet (teveel) slowchatten tussen de lijstjes door, zodat ik een beetje overzicht kan houden. - Het album moet in 2018 uitgekomen zijn; - Uiteraard is het maar toegestaan om één lijst te plaatsen. Dit zal nauwkeurig in de gaten worden gehouden; - Om mee te mogen stemmen, dien je geregistreerd te zijn bij ZM vóór vandaag 16-12-2018. - Graag je lijst uiterlijk 4 januari 2019 insturen! De uitslag zal daarna spoedig op de frontpage geplaatst worden; - Graag volledige titels; - MAXIMAAL EEN TOP 20 IS TOEGESTAAN! MINIMAAL 10. Lijstjes korter dan 10 worden geschrapt; - Geen re-releases, geen boxsets, geen DVD's, geen verzamelaars, geen splits, geen live-albums en geen mini's/singles/demo's/EP's. Hier doen we bij echte twijfelgevallen natuurlijk niet moeilijk, maar we proberen hier een albumjaarlijst samen te stellen. - Mocht je je in dit topic geplaatste lijst willen wijzigen, quote dan alsjeblieft je lijst en plaats je nieuwe lijst als reactie op je eigen quote. Dit zodat ik niet steeds hoef terug te zoeken. LIEFST WEL ZO WEINIG MOGELIJK WIJZIGINGEN, DUS PROBEER JE DEFINITIEVE LIJST TE PLAATSEN! - Mailen van je jaarlijst mag ook: jaarlijst@zwaremetalen.com (onderwerp 'ZM Jaarlijst') Succes en bedankt voor de moeite alvast en voor het in acht nemen van bovenstaande punten! [Dit bericht is gewijzigd door iPim op 29-12-2018 1:08] Vladimir: That passed the time. Estragon: It would have passed in any case. ![]() |
|
01. The Body - I have fought against it but I can't any longer 02. Servants of the Apocalyptic Goat Rave - Queen of Darkness 03. Ultha - The Inextricable Wandering 04. Wiegedood - De doden heb het goed III 05. Anaal Nathrakh - A new Kind of Horror 06. Virgin Black - Requiem Pianissimo 07. Cloak of Altering - Zero Devil 08. Abstracter - Cinereaous Incarnate 09. Orphaned Land - Unsung Prophets and Dead Messiahs 10. Einar Selvik & Ivar Bjornson - Hugsja 11. Primordial - Exile amongst the Ruins 12. Deafheaven - Ordinary Corrupt Human Love 13. Gnaw Their Tongues - Genocidal Majesty 14. Alien Weaponry - Tu 15. Sleep - The Sciences 16. Ihsahn - Amr 17. Yob - Our Raw Heart 18. Suffering Quota - Life in Disgust 19. Immortal - Northern Chaos Gods 20. Azaghal - Valo Pohjoisesta ![]() |
|
Abstracter – Cinerous Incarnate Pa Vesh En - Church of Bones Death Scepter – Black Trance Low - Double Negative Nothing – Dance on the Blacktop Occelensbrigg - The Cosmic Winter State Black Howling - Return of Primordial Stillness Craft – White Noise and Black Metal Soft Kill – Savior Bosse-de-Nage – Further still Wiegedood – De Doden Hebben het Goed III Beach House – 7 Drudkh – They Often See Dreams About the Spring Angantyr - Ulykke Manes – Slow Motion Death Sequence Cosmic Church – Tayttymys King Dude – Music to make war to Iceage – Beyondless Interpol - Marauder Behemoth – I loved you at your darkest ![]() |
|
01) Dautha - Brethren of the Black Soil 02) Burial Invocation - Abiogenesis 03) Solstice - White Horse Hill 04) Mare - Ebony Tower 05) Witchsorrow - Hexenhammer 06) Varathron — Patriarchs of Evil 07) Taphos - Come Ethereal Somberness 08) Ataraxy - Where All Hope Fades 09) Apostle of Solitude - From Gold to Ash 10) Mournful Congregation - The Incubus of Karma 11) Obliteration - Cenotaph Obscure 12) Seven Sisters - The Cauldron and the Cross 13) Pale Divine - s/t 14) Horrendous - Idol 15) Messa - Feast for Water 16) Wytch Hazel - II: Sojourn 17) Iron Void - Excalibur 18) Ghastly - Death Velour 19) Tribulation - Down Below 20) Evoken - Hypnagogia ![]() |
|
01. Helrunar - Vanitas Vanitatvm 02. Thou - Magus 03. Pijn - Loss 04. Uada - Cult of a Dying Sun 05. Doomed - 6 Anti-Odes To Life 06. Lowen - A Crypt in the Stars 07. Verheerer - Maltrér 08. Sleep - The Sciences 09. Gaerea - Unsettling Whispers 10. Evoken - Hypnagogia 11. Drudkh - They Often See Dreams About the Spring 12. Immortal - Northern Chaos Gods 13. Wiegedood - De Doden Hebben Het Goed III 14. Ultha - The Inextricable Wandering 15. Ancestors - Suspended in Reflections 16. Décembre Noir - Autumn Kings 17. Throneless - Cycles 18. Spurv - Myra 19. Messa - Feast for Water 20. Besra - Anhedonia Weep not for me.....it`s all the better lost ![]() |
|
1. The Night Flight Orchestra - Sometimes the World Ain't Enough 2. Carpenter Brut - Leather Teeth 3. Ace Frehley - Spaceman 4. Judas Priest - Firepower 5. Overruled - Hybris 6. Against Evil - All Hail the King 7. Christian Tolle Project - Point Blank 8. Gama Bomb - Speed Between the Lines 9. Alien Weaponry - Tū 10. Audrey Horne - Blackout 11. Hatesphere - Reduced to Flesh 12. Hatchet - Dying to Exist 13. Metal Church - Damned If You 14. Michael Romeo - War of the Worlds // Pt. 1 15. Objector - Social Intolerance Hier had uw advertentie kunnen staan! ![]() |
|
Kleine aanpassing. Kan dat nog? 1. Ghost - Prequelle 2. High on fire - Electric Messiah 3. Clutch - Book of bad decisions 4. Aura Noir - Aura Noire 5. Necrophobic - Mark of the necrogram 6. First aid kit - Ruins 7. Joe Bonamassa - Redemption 8. Nile Rodgers & Chic - It’s about time 9. Imagine dragons - Origins 10. A perfect circle - Eat the elephant [Dit bericht is gewijzigd door bastianus op 30-12-2018 19:40] Het radicale feminisme is niet eens een lachnummer meer: het is een karikatuur van een parodie op een klucht. ![]() |
|
#magikmijnextreemlolligejaarlijstmetfictievemetalclichesweerpostenoflieverniet? When your people matter, menstrual health matters ![]() |
|
1. Chapel Of Disease - ...And As We Have Seen The Storm, We Have Embraced The Eye 2. Pale Divine - Pale Divine 3. Horrendous - Idol 4. Funeral Mist - Hekatomb 5. Varathron - Patriarchs Of Evil 6. Burial Invocation - Abiogenesis 7. Solstice - White Horse Hill 8. Tribulation - Down Below 9. Corpsessed - Impetus Of Death 10. Primordial - Exile Among The Ruins 11. Satan - Cruel Magic 12. Chaos Echoes - Mouvement 13. Vanhelgd - Deimos Sanktuarium 14. Convocation - Scars Across 15. Faal - Desolate Grief 16. Obliteration – Cenotaph Obscure 17. Mournful Congregation - The Incubus Of Karma 18. Ataraxy – Where All Hope Fades 19. Hooded Menace – Ossuarium Silhouettes Unhallowed 20. Atavisma – The Chthonic Rituals ![]() |
|
Jeetje, wat is er veel uitgekomen dit jaar. Moeilijk om een definitieve keuze te maken, maar bij deze een poging. Of het helemaal in de perfecte volgorde is, daar kom ik denk ik nooit helemaal uit, maar de lijst moet toch in een volgorde staan... :-) Jaarlijst 2018 1. Cataya - Firn 2. Hugsjá - Hugsjá 3. Warrel Dane – Shadow Work 4. Carpenter Brut – Leather Teeth 5. In Vain - Currents 6. Shining - Animal 7. Primordial - Exile Amongst the Ruins 8. Wiegedood - De Doden Hebben het Goed III 9. Amorphis – Queen of TIme 10. At The Gates – To Drink from the Night itself 11. Tribulation - Down Below 12. Zeal & Arbor - Stranger Fruit 13. Shylmagoghnar – Transcience 14. The Ocean – Phanerozoic I: Palaezoic 15. Behemoth – I loved you at your Darkest 16. Uada - Cult of a Dying Sun 17. Harakiri for the Shy – Arson 18. Slægt – The Wheel 19. Summoning - With Doom We Come 20. Myles Kennedy - Year of the Tiger "Victimize me, vilify me. Vilipend and amend the sins you condign. You are nothing and you speak for all that never was." ![]() |
|
1) Urfaust - The constellatory Practice 2) Spectral Wound - Infernal Decadence 3) Sleep - The Sciencess 4) Panopticon - The Scars of Man on the Once Nameless Wilderness 5) Kriegsmaschine - Apocalypticists 6) Ultha - The Inextricable Wandering 7) Daughters - You Won't Get What You Want 8) Unreqvited - Stars Wept to the Sea 9) One Tail, One Head - Worlds Open, Worlds Collide 10) Rûr - RÛR 11) Imperial Triumphant - Vile Luxury 12) Bloodbath - The Arrow of Satan is Drawn 13) Shining - Varg Utan Flock 14) Skeletonwitch - Devouring Radiant Light 15) Sargeist - Unbound 16) Watain - Trident Wolf Eclipse 17) Vermilia - Kätkyt 18) Gamma Bomb - Speed Between the Lines 19) Portal - Ion 20) Harakiri for the Sky - Arson [Dit bericht is gewijzigd door Volke op 17-12-2018 14:12] "To learn who rules over you, simply find out who you are not allowed to criticise" ![]() |
|
1. Zeal & Ardor - Stanger Fruit 2. Behemoth - I Love You At Your Darkest 3. Deafheaven - Ordinary Corrupt Human Love 4. Ultha - The Inextricable Wandering 5. Wiegedood - De Doden Hebben Het Goed III 6. Ancestors - Suspended In Reflections 7. In The Woods.. - Cease The Day 8. Anal Nathrakh - A New Kind Of Horror 9. MØL - Jord 10. Horrendous - Idol 11. Conan - Existential Void Guardians 12. High On Fire - Electric Messiah 13. Rivers Of Nihil - Where Owls Know My Name 14. Shinning - X Varg Utan Flock 15. Revocation - The Other Ones 16. Khorada - salt 17. Ancst - Ghosts Of The Timeless Void 18. Joe Bonamassa - Redemption 19. Boss Keloid - Melted On The Inch 20. Long Distance Calling - Boundless [Dit bericht is gewijzigd door Bannink op 22-12-2018 7:50] ![]() |
|
quote: - Geen re-releases, geen boxsets, geen DVD's, geen verzamelaars, geen splits, geen live-albums en geen mini's/singles/demo's/EP's. Hier doen we bij echte twijfelgevallen natuurlijk niet moeilijk, maar we proberen hier een albumjaarlijst samen te stellen. ![]() |
|
01. Current 93 - The Light Is Leaving Us All 02. Panopticon - The Scars of Man on the Once Nameless Wilderness 03. Crippled Black Phoenix - Great Escape 04. Ivar Bjørnson & Einar Selvik- Hugsja 05. Sleep - The Sciences 06. Trembling Bells - Dungeness 07. Sangre de Muerdago - Noite 08. Anna von Hausswolff - Dead Magic 09. Spiritual Front - Amour Braque 10. Zu93 - Mirror Emperor 11. Bobby Beausoleil - Voodoo Shivaya 12. Dead Meadow - The Nothing They Need 13. Low - Double Negative 14. Årabrot - Who Do You Love 15. Wolvennest - VOID 16. King Dude - Music to Make War to 17. Winterfylleth - The Hallowing of Heirdom 18. Tribulation - Down Below 19. Monster Magnet - Mindfucker 20. Tusmørke - Fjernsyn I Farver [Dit bericht is gewijzigd door zodiac lung op 17-12-2018 18:29] ![]() |
|
1. Ghost - Prequelle 2. Amorphis - Queen of Time 3. Behemoth - I Loved You at Your Darkest 4. Heidevolk - Vuur van Verzet 5. At the Gates - To Drink From the Night Itself 6. Skeletonwitch - Devouring Radiant Light 7. Ivar Bjørnson & Einar Selvik - Hugsjá 8. Judas Priest - Firepower 9. YOB - Our Raw Heart 10. Anaal Nathrakh - A New Kind of Horror [Dit bericht is gewijzigd door Svartekunst op 17-12-2018 20:07] ![]() |
|
Een enigszins aangepaste lijst, want mijn nummber 1 van dit jaar is een live-album: Live Over Europe van Fates Warning. Geweldig live album, voor mij op het zeldzame niveau van albums als Strangers In The Night (UFO) en On Stage (Rainbow). Maar hierbij de lijst binnen de kaders voor de ZM jaarlijst: 1. Amorphis - Queen Of Time 2. Mile Marker Zero - The Fifth Row 3. Haken - Vector 4. Kingcrow - The Persistence 5. In Vain - Currents 6. Dynazty - Firesign 7. Michael Romeo - War Of The Worlds Part 1 8. Riverside - Wasteland 9. Tomorrow's Eve - Mirror Of Creation III, Project Ikaros 10. Seventh Wonder - Tiara 11. Mayan - Dhyana 12. The Pineapple Thief - Dissolution 13. Oceans Of Slumber - The Banished Heart 14. Uriah Heep - Living The Dream 15. Damian Wilson & Adam Wakeman - The Sun Will Dance In Its Twilight Hour 16. Monuments - Phronesis 17. The Night Flight Orchestra - Sometimes The World Ain't Enough 18. Kamelot - The Shadow Theory 19. Judas Priest - Firepower 20. The Sea Within - The Sea Within ![]() |
|
1. Riverside - Wasteland 2. Arena - Double Vision 3. Southern Empire - Civilisation 4. Ghost - Prequelle 5. Voivod - The Wake 6. Immortal - Northern Chaos Gods 7. The Sea Within - The Sea Within 8. A Perfect Circle - Eat the Elephant 9. Judas Priest - Firepower 10. Oceans of Slumber - Banished Heart ![]() |
|
01. Carpenter Brut - Leather Teeth 02. Paul Kalkbrenner - Parts of Life 03. Ancestors - Suspended in Reflections 04. Lycia - In Flickers 05. Sleep - The Sciences 06. Masta Ace & Marco Polo - A Breukelen Story 07. Crippled Black Phoenix - Great Escape 08. Cloud Nothings - Last Burning Building 09. Uncle Acid & the Deadbeats - Wasteland 10. Turnstile - Time & Space 11. Urfaust - The Constellatory Practice 12. Deafheaven - Ordinary Corrupt Human Love 13. Summoning - With Doom We Come 14. Solar Temple - Fertile Descent 15. Ghost - Prequelle [Dit bericht is gewijzigd door Northward op 18-12-2018 2:40] ![]() |
|
1. Ævangelist - Matricide in the Temple of Omega 2. Arkhtinn - 最初の災害 3. Servants Of The Apocalyptic Goat Rave - Queen Of Darkness 4. Reverorum ib Malacht - Im Ra Distare Summum Soveris Seris Vas innoble 5. Mahr - Antelux 6. Master Boot Record - Virus.DOS 7. Borgne - [∞] 8. Hardcore Anal Hydrogen - HyperCut 9. Stilla - Synviljor 10. The Body – I Have Fought Against It, But I Can’t Any Longer 11. Pryapisme - Epic Loon OST 12. Clouds - Dor 13. Ov Shadows - The Darkness Between Stars 14. Amaranthe - Helix 15. Himelvaruwe - Hemelpoort 16. Convocation - Scars Across 17. Unreqvited - Stars Wept to the Sea 18. Knokkelklang - Jeg Begraver 19. Entropia - Vacuum 20. Solar Temple - Fertile Descent signature ![]() |
|
1. Amorphis-Queen of Time 2. Kamelot- The Shadow Theory 3. Judas Priest- Firepower 4. Behemoth- I Love You at your Darkest 5. Primal Fear-Apocalypse 6. Kataklysm-Meditations 7. Lizzy Borden - My Midnight Things 8. Powerwolf - The Sacrament Of Sin 9. Manticora - To Kill To Live To Kill 10. Dynazty - Firesign ![]() |
|
Het was nog even puzzelen welke nou de beste van afgelopen jaar was maar ik ben eruit: 1: Borgne - [∞] 2: A Forest Of Stars - Grave Mounds And Grave Mistakes 3: Wiegedood - De Doden Hebben Het Goed III 4: Urfaust - The Constellatory Practice 5: Mournful Congregation - The Incubus of Karma 6: Summoning - With Doom We Come 7: Anaal Nathrakh - A New Kind Of Horror 8: Immortal - Northern Chaos Gods 9: Aborted - TerrorVision 10: Wolfheart - Constellation Of The Black Light 11: Atra Vetosus - Apricity 12: Angantyr – Ulykke 13: Ingested - The Level Above Human 14: Fukpig - Bastards 15: Ancst - Ghosts Of The Timeless Void 16: Down Among The Dead Men - ….And You Will Obey Me 17: Kraanium - Slamchosis 18: Marduk - Viktoria 19: Barren Earth - A Complex Of Cages 20: Shining - X - Varg Utan Flock [Dit bericht is gewijzigd door MisterIT op 18-12-2018 22:12] ![]() |
|
1. Sleep - The Sciences 2. Turnstile - Time & Space 3. Candy - Good to Feel 4. Damu the Fudgemunk & Flex Mathews - Dreams & Vibrations 5. Bombino - Deran 6. Ecostrike - Voice of Strength 7. Horrendous - Idol 8. Trail of Lies - W.A.R. 9. Death Grips - Year of the Snitch 10. Krimewatch - Krimewatch 11. Primal Rite - Dirge of Escapism 12. Aborted - TerrorVision 13. Merzbow - Monoakuma 14. Skyglow - Thousand Years of Terror 15. Vein - errorzone 16. Westside Gunn - Supreme Blientele 17. Judas Priest - Firepower 18. Spiritual Front - Amour Braque 19. Jesus Piece - Only Self 20. Andre Nickatina - Pisces ![]() |
|
1. Deafheaven - Ordinary Corrupt Human Love 2. Shame - Songs of Praise 3. Behemoth - I Loved You At Your Darkest 4. Ghost - Prequelle 5. Greta van Fleet - Anthem Of The Peaceful Army 6. Sleep - The Sciences 7. Immortal - Northern Chaos Gods 8. IDLES - Joy As An Act Of Resistance 9. Conan - Existential Void Guardian 10. Watain - Trident Wolf Eclipse 11. Yob - Our Raw Heart 12. Earthless - Black Heaven 13. DeWolff - Thrust 14. The Sore Losers - Gracias Señor 15. Jeugd van Tegenwoordig - Leuk [Dit bericht is gewijzigd door Cees_Masterkiller op 19-12-2018 16:11] A metalheart is hard to tear apart ![]() |
|
1) Winterfylleth: the Hallowing of heirdom 2) Mol: Jord 3) God is an Astronaut: Epitaph 4) Spurv: Myra 5) Primordial: Exile amongst the Ruins 6) Unreqvited: Stars wept to the Sea 7) Immortal : Northern Chaos Gods 8) Heidevolk: Vuur van Verzet 9) Mournful Congregation: the Incubus of Karma 10) Drudkh: They often see Dreams About the Spring 11) Wiegedood: de Doden hebben het Goed III 11) Monotheïst: Scourge 12) Revocation: The Outer Ones 13) Summoning: With Doom we Come 14) Amorphis: Queen of Time 15) Deathwhite: for a Black Tomorrow ![]() |
|
Dit zijn tot nu toe de originelen in huis: 01. Cosmic Atrophy - The Void Engineers 02. Slugdge - Esoteric Malacology 03. Ectoplasma - Cavern of foul unbeings 04. Augury - Illusive Golden Age 05. Voivod – The Wake 06. Of Feather and Bone - Bestial Hymns of Perversion 07. Ghost – Prequelle 08. Pestilence - Hadeon 09. Alkaloid - Liquid Anatomy 10. Aborted - Retrogore 11. Monstrosity - The Passage of Existence 12. Mammoth Grinder - Cosmic Crypt 13. Skeletal Remains - Devouring Mortality 14. Judas Priest- Firepower 15. Necrophobic - Mark of the Necrogram 16. Rivers of Nihil - Where Owls Know My Name 17. Dimmu Borgir – Eonian 18. Kalmah - Palo 19. Terrorizer - Caustic attack 20. Ritual Necromancy - Disinterred Horror 21. Night in Gales - The Last Sunsets 22. Burial Invocation - Abiogenesis 23. Hooded Menace - Ossuarium Silhouettes Unhallowed 24. Skinless – Savagery 25. Visigoth - Conqueror’s Oath En dit de runners up: 26. Beyond Creation - Algorythm 27. The Beast of Nod – Vampira: disciple of chaos 28. Outre tombe - Necrovortex 29. Slaughterday - Abattoir EP 30. Gorod - Aethra 31. Blame - Almanac 32. Horizon Ablaze - The Weight of a Thousand Suns 33. Bloodshot Dawn - Reanimation 34. Varathron - Patriarchs of Evil 35. Baest - Danse macabre 36. Cancer - Shadow gripped 37. Krisiun - Scourge of the enthroned 38. Immortal - Northern Chaos Gods 39. Obscura - Diluvium 40. Skeletonwitch - Devouring Radiant Light 41. Sigh – Heir to despair 42. Portal - Ion 43. Sacral Rage – Beyond celestial echoes 44. Arsis - Visitant 45. Soulfly - Ritual 46. Cist - The Frozen Casket 47. Deicide - Overtures of blasphemy 48. Amorphis - Queen of time 49. Sadist – Spellbound 50. Created to kill - Summoned to rise 51. Hyperdontia - Nexus of teeth 52. Soreption - Monument of the End 53. Serocs - The Phobos / Deimos Suite En dit gaat nog een luisterrondje krijgen: Firtan - Okeanos Psycroptic - As the Kingdom Drowns Lecherous Nocturne - Occultaclysmic Redemption - Long Night's Journey into Day Dead End - The mind's asylum Enfold Darkness - Adversary Omnipotent Virulent Depravity - Fruit Of The Poisioned Tree Anomalie - Integra Siege of Power - Warning Blast Decaying - To Cross the Line Crippled Black Phoenix - Great Escape Jungle Rot - Jungle Rot The Crown - Cobra Speed Venom Veld - S.I.N. Sun Speaker - Ov Lustra Dallian - Automata Mechina - The Compendium Temple- Design in Creation Bloodbath - The Arrow of Satan Is Drawn Behemoth - I Loved You at Your Darkest Inferi - Revenant Alpha Ascension - Adventures in J-Town Alterbeast - Feast (tech) Convulsing - Grievous Oubliette - The passage Revocation - The outer ones Sulphur Aeon - The scythe of cosmic chaos Irreversible Mechanism - Immersion Aethereus - Absentia [Dit bericht is gewijzigd door Mutilator op 20-12-2018 18:16] The quality of our perceptions determines the quality of our judgement. Our judgement determines how we interact with the world. How we interact with the world changes the world. So, the quality of our perceptions changes the world. ![]() |
![]() |
Dit topic is 8 pagina's lang: 1 2 3 4 5 6 7 8 |
![]() |
Index / Muziek algemeen | ![]() |
![]() |
![]() |
![]() |
![]() |